PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG081300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 1014aa    MW: 112022 Da    PI: 4.9411
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG081300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.63.8e-204894148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT+eEd++l +av+ + g++Wk+Ia++++ gRt+ qc +rwqk+l
  Pavir.3KG081300.1.p 48 KGNWTAEEDDILRKAVETYKGKNWKKIAECFP-GRTDVQCLHRWQKVL 94
                         79******************************.************986 PP

2Myb_DNA-binding59.38.5e-19100146148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          +g+W++eEd+++++ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  Pavir.3KG081300.1.p 100 KGPWSKEEDDIIIQMVNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 146
                          79******************************.*************97 PP

3Myb_DNA-binding45.32e-14152194145
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                          + +WT+eE+ +l+++++ +G++ W+   + ++ gRt++ +k++w+
  Pavir.3KG081300.1.p 152 KEAWTQEEEIKLIHVHQTYGNK-WAELTKFLP-GRTDNAIKNHWH 194
                          579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.1794394IPR017930Myb domain
SuperFamilySSF466897.18E-1746103IPR009057Homeodomain-like
SMARTSM007171.1E-184796IPR001005SANT/Myb domain
PfamPF002491.5E-174894IPR001005SANT/Myb domain
CDDcd001676.90E-165094No hitNo description
Gene3DG3DSA:1.10.10.603.4E-2550111IPR009057Homeodomain-like
PROSITE profilePS5129431.56895150IPR017930Myb domain
SuperFamilySSF466891.08E-3097193IPR009057Homeodomain-like
SMARTSM007171.3E-1799148IPR001005SANT/Myb domain
PfamPF002492.5E-17100146IPR001005SANT/Myb domain
CDDcd001673.41E-15102146No hitNo description
Gene3DG3DSA:1.10.10.607.4E-26112153IPR009057Homeodomain-like
PROSITE profilePS5129419.318151201IPR017930Myb domain
SMARTSM007171.3E-13151199IPR001005SANT/Myb domain
PfamPF002496.6E-13152194IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-21154201IPR009057Homeodomain-like
CDDcd001671.80E-10154194No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1014 aa     Download sequence    Send to blast
MTSEGQMTSK GTEASAPAVP PDEGVRKEPQ KGRLPNGRTT GPARRSSKGN WTAEEDDILR  60
KAVETYKGKN WKKIAECFPG RTDVQCLHRW QKVLNPELVK GPWSKEEDDI IIQMVNKLGP  120
KKWSTIAQAL PGRIGKQCRE RWHNHLNPGI NKEAWTQEEE IKLIHVHQTY GNKWAELTKF  180
LPGRTDNAIK NHWHSSVKKK IDSYRASGLL AQFQGLAPVE YTTGGLSVDS SSAMTNQISE  240
DSGLNIFREV EDSTELSQSS FAKGSCSQEE LTDVTLGSHL NVHESLCQDG FINADNAASA  300
LPEMHHQLST SDMDQDKHFQ DELSQGMDLD KQLQLQQEFS QGMDLHLDID EVPNNFVMTD  360
SHASNELTGQ FQDTQIMHSS ENGVSLIPYA VTPCVSILPS VPECDNNINM MCEVGIKNED  420
CFQTEQWQNI SIEPGSYSSE AANNFSAPLY PLQTSEPATM MGGPSNYQTF VTSLPPSFIS  480
SDGTSNASDV KFEKNRCSVS HQDLEIKTCH NSSGDPDQSS YISSEGDRNR TSEPMDSIPD  540
SEKKQLVDLE QSCLEPISCE GDRNRISESM DSIPDSEKKQ LVDLEQSCLE PTAYIGKEAL  600
SSHGDSVLSE KEDAGALCYE PPCFASFEVP FVSCELVTSS DLPEYSPLGI RELMRSSLNF  660
PTPVRLWGSP TRDGSPDAVL KNAAKSFVCT PSIMKKRPRD LSSPTPDIRN EKKLNAEKDC  720
GRSGMSSTRI GKSCMDTPDD FVDLVSPTRK TAFQKKLKLS QENKENLNQI TDQGENEGNA  780
KVNHFTEGKR CSTVNSDSTN SLHSAGILTD RSVDNLNTPK HGPNYESQRL NTSTKAWSNS  840
KDIIFSRSKP SELLVEKSIP CIDADYEYVN ILADTPGIKR GLESPSAWKS PLFTPFQDAY  900
FMSPASRAFD ALGLVKQINE QSAAALEEAH EVLASGSPWK RHCKENNDKE NTAWKNEVGT  960
SKPPSKPMAE GRVLDFNECS TPVRKKEDKT VDLALGGSAS SSVASSYLWM NVR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C9e-65482016159MYB PROTO-ONCOGENE PROTEIN
1h88_C9e-65482016159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.184061e-104leaf| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960646.10.0PREDICTED: myb-related protein 3R-1
RefseqXP_004960647.10.0PREDICTED: myb-related protein 3R-1
RefseqXP_004960645.10.0PREDICTED: myb-related protein 3R-1
TrEMBLK3Z3V00.0K3Z3V0_SETIT; Uncharacterized protein
STRINGSi021218m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-102myb domain protein 3r-4